Reviewed
Homo Sapiens (Human) [TaxID: 9606]
P/V
Non-structural protein V (Non-structural protein NS1)
Mumps Virus (strain SBL) (MuV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mumps Rubulavirus> Mumps Virus Genotype A> Mumps Virus (strain SBL) (MuV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDQFIKQDETGDLIETGMNVANHFLSAPIQGTNSLSKASIIPGVAPVLIGNPEQKNIQHPTASHQGSKSKGSGSGVRSIIVPPSEAGNGGTQDPEPLFAQ
TGQGGIVTTVYQDPTIQPTGSSRSVELAKIGKERMINRFVEKPRISTPVTEFKRGAGSGCSRPDNPRGGHRREWSLSWVQGEVRVFEWCNPICSPITAAA
RFHSCKCGNCPAKCDQCERDYGPP
TGQGGIVTTVYQDPTIQPTGSSRSVELAKIGKERMINRFVEKPRISTPVTEFKRGAGSGCSRPDNPRGGHRREWSLSWVQGEVRVFEWCNPICSPITAAA
RFHSCKCGNCPAKCDQCERDYGPP
224
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays an essential role in the inhibition of host immune response. Prevents the establishment of cellular antiviral state by blocking interferon-alpha/beta (IFN-alpha/beta) production and signaling pathway. Interacts with host IFIH1/MDA5 and DHX58/LGP2 to inhibit the transduction pathway involved in the activation of IFN-beta promoter, thus protecting the virus against cell antiviral state. Blocks the type I and II interferon signaling pathways by interacting with host STAT1, STAT2 and STAT3, and mediating their ubiquitination and subsequent proteasomal degradation (By similarity).
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available