viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
P/V
Non-structural protein V (Non-structural protein NS1)
Mumps Virus (strain SBL) (MuV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mumps Rubulavirus> Mumps Virus Genotype A> Mumps Virus (strain SBL) (MuV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDQFIKQDETGDLIETGMNVANHFLSAPIQGTNSLSKASIIPGVAPVLIGNPEQKNIQHPTASHQGSKSKGSGSGVRSIIVPPSEAGNGGTQDPEPLFAQ
TGQGGIVTTVYQDPTIQPTGSSRSVELAKIGKERMINRFVEKPRISTPVTEFKRGAGSGCSRPDNPRGGHRREWSLSWVQGEVRVFEWCNPICSPITAAA
RFHSCKCGNCPAKCDQCERDYGPP
224
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in the inhibition of host immune response. Prevents the establishment of cellular antiviral state by blocking interferon-alpha/beta (IFN-alpha/beta) production and signaling pathway. Interacts with host IFIH1/MDA5 and DHX58/LGP2 to inhibit the transduction pathway involved in the activation of IFN-beta promoter, thus protecting the virus against cell antiviral state. Blocks the type I and II interferon signaling pathways by interacting with host STAT1, STAT2 and STAT3, and mediating their ubiquitination and subsequent proteasomal degradation (By similarity).
Not Available
GO:0030430  ;   GO:0039502  ;   GO:0039554  ;   GO:0039563  ;   GO:0039564  ;  
GO:0046872  
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available