Reviewed
Homo Sapiens (Human) [TaxID: 9606]
D10R[Gene ID: 1486416 ]
mRNA-decapping protein D10 (EC 3.1.3.-)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MNFYRSSIISQIIKYNRRLAKSIICEDDSQIITLTAFVNQCLWCHKRVSVSAILLTTDNKILVCNRRDSFLYSEIIRTRNMSRKKRLFLNYSNYLNKQER
SILSSFFSLDPATIDNDRIDAIYPGGILKRGENVPECLSREIKEEVNIDNSFVFIDTRFFIHGIIEDTIINKFFEVIFFVGRISLTSDQIIDTFKSNHEI
KDLIFLDPNSGNGLQYEIAKYALDTAKLKCYGHRGCYYESLKKLTEDD
SILSSFFSLDPATIDNDRIDAIYPGGILKRGENVPECLSREIKEEVNIDNSFVFIDTRFFIHGIIEDTIINKFFEVIFFVGRISLTSDQIIDTFKSNHEI
KDLIFLDPNSGNGLQYEIAKYALDTAKLKCYGHRGCYYESLKKLTEDD
248
Not Available
Not Available
01-10-1993
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Decapping enzyme required for the removal of the 5'-end m7GpppN cap tethered to viral and host mRNAs to allow their decay in cells. May therefore accelerate viral and cellular mRNA turnover to eliminate competing host mRNAs and allow stage-specific synthesis of viral proteins. Acceleration of the turnover of cellular transcripts may even promote the shutoff of host protein synthesis (By similarity).
3.1.3.-
Not Available
DOMAIN 45 227 Nudix hydrolase.
MOTIF 126 147 Nudix box.
Predicted/Modelled
Not Available
ACT_SITE 141 141 Nucleophile.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available