viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
RAP94 H4L[Gene ID: 1486442 ]
RNA polymerase-associated transcription-specificity factor RAP94 (Protein H4) (RPO-associated protein of 94 kDa)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MDSKETILIEIIPKIKAYLLDANISPKSYDDFISRNKNIFVINLYNVSAITEEDIRLLYTTIEQNIDANDQTLVAIFSYIGYKFEQTVKEEISTSLSLND
KNTTDEMTYNLYDLFFNTLDMYLRQKKISILVNDDVRGDVIVSYKNSDLVSSFNAELEPEIKKIPFNMKNLLPYLEKNLDQLRFSKKYLDFAYLCRHIGI
PISKKKYNVRYVFLYKIDGLSIPIIIKDFLDVKYVYLENTGKIYKNSFSEDHNNSLSDWGKVIIPLLKDRHLYSYIFLSSYHLHSYYTDLIAKDEPVFIK
RKKLDIIEIDEPEAWKRDVKVEFAPCEHQIRLKEAMKVDANYFTKINNFANEFIYYEDGVAYCRVCGINIPIFNLDAADVIKNTVIVSTFNKTIFLSEPY
SYFVHSQRFIFNIIMSFDNIMKSQTWVMKYNINRLILNFFIDINSRRQEYEKKFSSEIKRGLFFLRLSANLFESQVSSTELFYVSKMLNLNYIVALVIIL
NSSADFIVSYMKSKNKTVEESTLKYAISVVIYDFLVKTRICEKGSLDTIVLFTDVYTSIMPEELDLHFQRITLELRKLVSIQRSALEPNYDVESRGEELP
LSTLKFFDTSTIIVKTMAPVHTYVEQKIVAPTPSVEPTDASLKQFKELTCDEDIKILIRVHDTNATKLVIFPSHLKIEIERKKLIIPLKSLYITNTLKYY
YSNSYLYIFRFGDPMPFEEELIDHEHAQYKINCYNILRYHLLPDSDVFVYFSNSLNREALEYAFYIFLSKYVNVKQWIDENITRIRELYMINFNN
795
Not Available
Not Available
01-10-1993
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
DNA-directed RNA polymerase-associated factor required for the transcription of viral early genes as well as for transcription termination. Within minutes after virus entry, recruits the core RNA polymerase, the early transcription factor (ETF) and other enzymes needed for transcription initiation, elongation, and termination thereby allowing synthesis of early mRNAs which are extruded through pores in the core particle. Recruits the multifunctional J3 protein, with poly(A) polymerase-stimulatory, cap nucleoside-2'-O-methyltransferase, and transcription elongation activities. Interacts with NPH-I, a DNA-dependent ATPase required for the termination of early transcripts. Acts as a transcription termination factor by binding, together with the capping enzyme/VTF, to the termination motif 5'-UUUUUNU-3' in the nascent mRNA. Involved as well in the packaging of RNA polymerase and other components needed for early transcription in assembling virus particles (By similarity).
Not Available
Virion . Note=All the enzymes and other proteins required to synthesize early mRNAs are packaged within the virion core along with the DNA genome. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available