viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
H7R[Gene ID: 1486445 ]
Late protein H7
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MEMDKRMKSLAMTAFFGELTTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDTYKASQYLDLPLTPISGDECKTHASSIAKQLACVDIIKEDISEY
IKTTPRLKRFIKKYRNRSDTRISQDTEKLKIALAKGIDYEYIKDAC
146
Not Available
Not Available
01-10-1993
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Contributes to the formation of crescents and immature virions (IV).
Not Available
♦ Membrane
♦ Single-pass membrane protein . Note=Probably transitorily part of the membrane of cresents during immature virions formation. Not incorporated into virions. Probably synthesized, but not retained in viral factories (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available