viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
FE1
Core phosphoprotein F17 (Fragment)
Vaccinia Virus (strain L-IVP) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain L-IVP) (VACV)
 
Various pathway(s) in which protein is involved
Not Available
Not Available
MNSHFASAHTPFYINTKEARYLVLKAVKVCDVRTVECEGSKA
42
Not Available
Not Available
01-04-1993
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Necessary for proteolytic processing of the major structural viral proteins P4a and P4b.
Not Available
Virion . Note=Virion core. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available