viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BBRF2[Gene ID: 3783686 ]
Cytoplasmic envelopment protein 1
Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)> Epstein-Barr Virus (strain B95-8) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MASGKHHQPGGTRSLTMQKVSLRVTPRLVLEVNRHNAICVATNVPEFYNARGDLNIRDLRAHVKARMISSQFCGYVLVSLLDSEDQVDHLNIFPHVFSER
MILYKPNNVNLMEMCALLSMIENAKSPSIGLCREVLGRLTLLHSKCNNLDSLFLYNGARTLLSTLVKYHDLEEGAATPGPWNEGLSLFKLHKELKRAPSE
ARDLMQSLFLTSGKMGCLARSPKDYCADLNKEEDANSGFTFNLFYQDSLLTKHFQCQTVLQTLRRKCLGSDTVSKIIP
278
Not Available
Not Available
01-04-1993
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm.
Not Available
Virion . Virion tegument . Host cytoplasm . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available