Results | viHumans

UniProt ID

P28283

Status

Reviewed

Host

Homo Sapiens (Human) [TaxID: 9606]

Gene Name

RL1 ICP34.5[Gene ID: 1487286;1487287 ]

Protein Name

Neurovirulence factor ICP34.5 (Infected cell protein 34.5) (protein gamma(1)34.5)

Organism Name

Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)

Taxonomic Lineage

Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)

RefSeq

Not Available

PubMed ID

1662697 ; 9499055

Pathways Involved

Various pathway(s) in which protein is involved

KEGG

vg:1487286;vg:1487287

Reactome

Not Available

Sequence

							MSRRRGPRRRGPRRRPRPGAPAVPRPGAPAVPRPGALPTADSQMVPAYDSGTAVESAPAASSLLRRWLLVPQADDSDDADYAGNDDAEWANSPPSEGGGK
APEAPHAAPAAACPPPPPRKERGPQRPLPPHLALRLRTTTEYLARLSLRRRRPPASPPADAPRGKVCFSPRVQVRHLVAWETAARLARRGSWARERADRD
RFRRRVAAAEAVIGPCLEPEARARARARARAHEDGGPAEEEEAAAAARGSSAAAGPGRRAV
						

Length

261

Alternate Sequence

Not Available

Non-standard residue

Not Available

Date of last Sequence modification

01-12-1992

Protein Existence

Inferred from homology

Amino Acid composition

Amino Acid	Count	% Frequency	Amino Acid	Count	% Frequency
Alanine (A)			Leucine (L)
Arginine (R)			Lysine (K)
Asparagine (N)			Methionine (M)
Aspartic Acid (D)			Phenylalanine (F)
Cysteine (C)			Proline (P)
Glutamine (Q)			Serine (S)
Glutamic Acid (E)			Threonine (T)
Glycine (G)			Tryptophan (W)
Histidine (H)			Tyrosine (Y)
Isoleucine (I)			Valine (V)

Sum of Absolute Deviation from Amino Acid Occurrence Frequencies

Aliphatic Index

Instability Index

Secondary Structure features

% Number of Residues in Helices	% Number of Residues in Strands	% Number of Residues in Coils

Structural Difficulty(SD) index

Role(s)

Contributes to HSV resistance to the antiviral effects of alpha/beta interferon. Recruits the serine/threonine-protein phosphatase PPP1CA/PP1-alpha to dephosphorylate the translation initiation factor eIF-2A, thereby couteracting the host shutoff of protein synthesis involving double-stranded RNA-dependent protein kinase EIF2AK2/PKR. Also down-modulates the host MHC class II proteins cell surface expression. Acts as a neurovirulence factor that has a profound effect on the growth of the virus in central nervous system tissue, probably through its ability to maintain an environment favorable for viral replication (By similarity).

EC

Not Available

Experimentally known GO terms

GO:0009405 ; GO:0019012 ; GO:0030430 ; GO:0039502 ; GO:0039521 ;
GO:0039586 ; GO:0044196

Subcellular Location

Host cytoplasm . Host nucleus, host nucleolus . Virion . Note=At early times in infection, colocalizes with PCNA and replication proteins in cell nuclei, before accumulating in the cytoplasm by 8 to 12 hours post-infection. The effects on the host cell are probably mediated by de novo-synthesized ICP34.5, the virion-derived population being either non-functional or present in very low amounts (By similarity). .

Domain(s)

Not Available

Motif(s)

MOTIF 128 137 Nuclear export signal. ; MOTIF 188 206 Bipartite nuclear localization signal.

Methods of 3D structure generation

Predicted/Modelled

Experimetally known structure

Not Available

Active Site(s)

Not Available

Predicted 3D Structures

Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.

Experimentally known Ligand(s)

Not Available

Virtually Screened Ligands

Virtual screening has been performed using RASPD

						Million Molecules

					
Best 20 Hit molecules 
Not Available