viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL56[Gene ID: 1487345 ]
Protein UL56
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MALGAGHAHACRDDGDDSVIDAPPPYESVAGASAGQFVVIDIDTPTDSPPPYSAGTSPVGLVSPASSGDGEVCERGRSRRAAWRAARRARRRAERRARRR
SFGPGGLFVETPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPPGGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARCASS
SDTPQAPGWCGGTCRHAVFGVVAVVVVIILAFLWR
235
Not Available
Not Available
01-12-1992
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the transport and release of virions form the host cytoplasm to the extracellular space. Relocalizes host NEDD4, a cytosolic E3 ligase, to cytoplasmic vesicles.
Not Available
♦ Host membrane
♦ Single-pass membrane protein . Host cytoplasm , . Note=If expressed alone, is predominantly present in host trans-Golgi network (TGN) and partially in Golgi complex and early endosomes. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available