Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL56[Gene ID: 1487345 ]
Protein UL56
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MALGAGHAHACRDDGDDSVIDAPPPYESVAGASAGQFVVIDIDTPTDSPPPYSAGTSPVGLVSPASSGDGEVCERGRSRRAAWRAARRARRRAERRARRR
SFGPGGLFVETPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPPGGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARCASS
SDTPQAPGWCGGTCRHAVFGVVAVVVVIILAFLWR
SFGPGGLFVETPLFLPETMIGAHPGVGGDLPSGLPTYAEATSDRPPTYAMVMAACPTEPPGGSVGPADQPRVQSSRTWRPPLVNSRELYRAQRAARCASS
SDTPQAPGWCGGTCRHAVFGVVAVVVVIILAFLWR
235
Not Available
Not Available
01-12-1992
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a role in the transport and release of virions form the host cytoplasm to the extracellular space. Relocalizes host NEDD4, a cytosolic E3 ligase, to cytoplasmic vesicles.
Not Available
♦ Host membrane
♦ Single-pass membrane protein . Host cytoplasm , . Note=If expressed alone, is predominantly present in host trans-Golgi network (TGN) and partially in Golgi complex and early endosomes. .
♦ Single-pass membrane protein . Host cytoplasm , . Note=If expressed alone, is predominantly present in host trans-Golgi network (TGN) and partially in Golgi complex and early endosomes. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available