viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL4[Gene ID: 1487326 ]
Nuclear protein UL4
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MGNPQTTIAYSLHHPRASLTSALPDAAQVVHVFESGTRAVLTRGRARQDRLPRGGVVIQHTPIGLLVIIDCRAEFCAYRFIGRASTQRLERWWDAHMYAY
PFDSWVSSSHGESVRSATAGILTVVWTPDTIYITATIYGTAPEAARGCDNAPLDVRPTTPPAPVSPTAGEFPANTTDLLVEVLREIQISPTLDDADPTPG
T
201
Not Available
Not Available
01-12-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available