viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NB
Glycoprotein NB
Influenza B Virus (strain B/Beijing/1/1987)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Betainfluenzavirus> Influenza B Virus> Influenza B Virus (strain B/Beijing/1/1987)
Various pathway(s) in which protein is involved
Not Available
Not Available
MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFIKNNCTNNDIGLRERIKCSGCEPLCNKRDDISSPRTGVDIPSFILPGLNLSESTPN
99
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Putative viral proton channel. May play a role in virus entry (By similarity).
Not Available
GO:0005216  ;   GO:0016021  ;   GO:0039707  ;   GO:0044385  ;   GO:0051259  ;  
GO:0055036  
♦ Virion membrane
♦ Single-pass type III membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available