Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E6[Gene ID: 1489281 ]
Protein E6
Human Papillomavirus Type 41
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Nupapillomavirus> Nupapillomavirus 1> Human Papillomavirus Type 41
Various pathway(s) in which protein is involved
Not Available
MASTSGVGSVGPASCCETQKPHTIRELCLAQQITYPCIQLCCHYCYKILSVLDIYAFDQSCLYLSWGEGGPTGICSQCTRVLARLEFTARHEVSCAASRL
PHFIGQSLSDLEVRCVRCLALLQSVEKDYILREDLSVHRIGGIWRGTCVRCMVGLY
PHFIGQSLSDLEVRCVRCLALLQSVEKDYILREDLSVHRIGGIWRGTCVRCMVGLY
156
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response.
Not Available
GO:0003677 ; GO:0006351 ; GO:0006355 ; GO:0030430 ; GO:0039503 ;
GO:0039526 ; GO:0042025 ; GO:0046872
GO:0039526 ; GO:0042025 ; GO:0046872
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available