viHumans
Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]
Gag[Gene ID: 6386656 ]
♦Gag polyprotein (Pr71Gag) [Cleaved into: Gag protein (p68)
♦ p3]
Simian Foamy Virus Type 3 (strain LK3) (SFVagm) (SFV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Spumaretrovirinae> Spumavirus> African Green Monkey Simian Foamy Virus> Simian Foamy Virus 3> Simian Foamy Virus Type 3 (strain LK3) (SFVagm) (SFV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
MGDHNLNVQELLNLFQNLGIPRQPNHREVIGLRMLGGWWGPGTRYILVSIFLQDDSGQPLQQPRWRPEGRPVNPLVHNTIEAPWGELRQAFEDLDVAEGT
LRFGPLANGNWIPGDEYSMEFQPPLAQEIAQMQRDELEEILDITGQICAQVIDLVDMQDAQIRGLERRIQDRLGLRDNLPVAGIQAPPSSPIGQPIASSS
LQPIPGSSSSPADLDGIWTPRQIDPRLSRVAYNPFLPGSSDGSGGSIPVQPSAPPAVLPSLPSLPAPVSQPIIQYVAQPPVPAPQAIPIQHIRAVTGNTP
TNPRDIPMWLGRHSAAIEGVFPMTTPDLRCRVVNALIGGSLGLSLEPIHCVNWAAVVAALYVRTHGSYPIHELANVLRAVVTQEGVATGFQLGIMLSNQD
YNLVWGILRPLLPGQAVVTAMQQRLDQEVNDAARITSFNGHLNDIYQLLGLNARGQSIARAQSASTSGNSASAGRGRRGQRTQQQAGRQQQQQTRRTNQG
NQGQRDNNQRQSSGGNQGQRGQGGYDLRPRTYQPQRYGGGRGRRWNDNQQQQQAQPGRSSDQPRSQSQQPQPEARGDQSRTSGAGRGQQGRGNQNRNQRR
ADANNTRNVDTVTATTTSSSTASSGQNGSSTTPPASGSRNQGD
643
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Involved in capsid formation and genome binding. Shortly after infection, interaction between incoming particle-associated Gag proteins and host dynein allows centrosomal targeting of the viral genome (associated to Gag), prior to nucleus translocation and integration into host genome (By similarity).
Not Available
GO:0003677  ;   GO:0003723  ;   GO:0019013  ;   GO:0019076  ;   GO:0030430  ;  
GO:0039702  ;   GO:0042025  ;   GO:0044163  ;   GO:0046718  ;   GO:0075521  
♦ Gag protein: Virion . Host nucleus . Host cytoplasm . Note=Gag protein is nuclear at initial phase, cytoplasmic at assembly. Shortly after infection, Gag protein is targeted to centrosomes. It is then actively transported into the nucleus thanks to its nuclear localization signal. In the late phases of infection, Gag proteins assemble in the cytoplasm to form the virion's capsids (By similarity). .
♦ p3: Virion .
Not Available
MOTIF 251 254 PTAP/PSAP motif.; MOTIF 523 544 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available