Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]
Env[Gene ID: 6386653 ]
♦Envelope glycoprotein gp130 (Env polyprotein) [Cleaved into: Leader peptide (LP) (Env leader protein) (Elp) (gp18LP)
♦ Surface protein (SU) (Glycoprotein 80) (gp80)
♦ Transmembrane protein (TM) (Glycoprotein 48) (gp48)]
♦ Surface protein (SU) (Glycoprotein 80) (gp80)
♦ Transmembrane protein (TM) (Glycoprotein 48) (gp48)]
Simian Foamy Virus Type 3 (strain LK3) (SFVagm) (SFV-3)
Viruses> Retro-transcribing Viruses> Retroviridae> Spumaretrovirinae> Spumavirus> African Green Monkey Simian Foamy Virus> Simian Foamy Virus 3> Simian Foamy Virus Type 3 (strain LK3) (SFVagm) (SFV-3)
Not Available
Various pathway(s) in which protein is involved
Not Available
MAPPMNLQQWLLWKKMNETHLALENISSLTEEQKQQVIIEIQQEEVIPTRMDRVKYLAYACCATSTRVMCWLFLICVLLIIVFVSCFVTVARIQWNRDIN
VFGPVIDWNVTHQATYQQLKAARLTRSLKVEHPHISYISINMSSIPQGVMYTPHPEPIILKERVLGISQVLMINSENIANVANLSQETKVLLTDMINEEL
QDLSNQMIDFELPLGDPRDQDQYIHHKCYQEFAHCYLVKYKKPSPWISEGIIVDQCPLPRIHDPNYYKYQPIWDYYLKIQNIRPQGWTSKSYYGTARMGS
FYIPTFLRNNTVSHVLFCSDQLYGKWYNIENNIQENEQLLKTKLYNLTTYSKLKARALPKEWNNQGNARLFRSFNPLDVCNRPEAVLLLNTTYFTYSLWE
GDCNYTTALIQNLTECRQPDRLKLKHPYACRFWRYKEGQEEVKCLGNEKKKCLYYSEYSSPEAQFDFGFLSYLNAFPGLKYIENQTVREPEYEVYSLYME
CMNSAEKYGIDSVLFALKTFLNFTGTPVNEMSTARAFVGLTDPKFPPTYPNITKEQKRCNNLKRRKRSTNIEKLRSMGYSLTGAVQTLSQISDINDERLQ
QGVSLLRDHVVTLMEAALHDITIMEGMLAIQHVHTHLNHLKTILLMRKIDWTFIKSNWIKEQLQKTEDEMKIIRRTAKSLVYYVTQTSSSTTATSWEIGI
YYEITIPKHIYLNNWQVINIGHLVESAGHLTLIRVKHPYEVINKECTYEQYLHLEDCISQDYVICDTVQIVSPCGNSTTTSDCPVTAEKVKEPYVQVSAL
KNGSYLVLTSRTDCSIPAYVPSIVTVNETVKCFGVEFHKPLYSESKVSFEPQVPHLKLRLPHLVGIIANLQNLEIEVTSTQESIKDQIERAKSQLLRLDI
HEGDFPAWIQQLASATRDVWPAAARALQGIGNVLSNTAQGIFGTTVSILSYAKPILIGIGVILLIAFLFKIVSWLPGKKKRN
VFGPVIDWNVTHQATYQQLKAARLTRSLKVEHPHISYISINMSSIPQGVMYTPHPEPIILKERVLGISQVLMINSENIANVANLSQETKVLLTDMINEEL
QDLSNQMIDFELPLGDPRDQDQYIHHKCYQEFAHCYLVKYKKPSPWISEGIIVDQCPLPRIHDPNYYKYQPIWDYYLKIQNIRPQGWTSKSYYGTARMGS
FYIPTFLRNNTVSHVLFCSDQLYGKWYNIENNIQENEQLLKTKLYNLTTYSKLKARALPKEWNNQGNARLFRSFNPLDVCNRPEAVLLLNTTYFTYSLWE
GDCNYTTALIQNLTECRQPDRLKLKHPYACRFWRYKEGQEEVKCLGNEKKKCLYYSEYSSPEAQFDFGFLSYLNAFPGLKYIENQTVREPEYEVYSLYME
CMNSAEKYGIDSVLFALKTFLNFTGTPVNEMSTARAFVGLTDPKFPPTYPNITKEQKRCNNLKRRKRSTNIEKLRSMGYSLTGAVQTLSQISDINDERLQ
QGVSLLRDHVVTLMEAALHDITIMEGMLAIQHVHTHLNHLKTILLMRKIDWTFIKSNWIKEQLQKTEDEMKIIRRTAKSLVYYVTQTSSSTTATSWEIGI
YYEITIPKHIYLNNWQVINIGHLVESAGHLTLIRVKHPYEVINKECTYEQYLHLEDCISQDYVICDTVQIVSPCGNSTTTSDCPVTAEKVKEPYVQVSAL
KNGSYLVLTSRTDCSIPAYVPSIVTVNETVKCFGVEFHKPLYSESKVSFEPQVPHLKLRLPHLVGIIANLQNLEIEVTSTQESIKDQIERAKSQLLRLDI
HEGDFPAWIQQLASATRDVWPAAARALQGIGNVLSNTAQGIFGTTVSILSYAKPILIGIGVILLIAFLFKIVSWLPGKKKRN
982
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦The surface protein (SU) attaches the virus to the host cell by binding to the cell receptor. This interaction triggers the refolding of TM and is thought to activate its fusogenic potential by unmasking its fusion peptide (By similarity).
♦ The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm (By similarity).
♦ The leader peptide is a component of released, infectious virions and is required for particle budding.
♦ The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm (By similarity).
♦ The leader peptide is a component of released, infectious virions and is required for particle budding.
Not Available
♦ Envelope glycoprotein gp130: Host endoplasmic reticulum membrane. Note=The polyprotein has a highly unusual biosynthesis for a retroviral glycoprotein. It is translated as a full-length precursor protein into the rough endoplasmic reticulum and initially has a type III protein configuration with both its N and C-termini located intracytoplasmically (By similarity). .
♦ Leader peptide: Virion membrane
♦ Single-pass type II membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Note=Its N-terminus is located inside the viral particle. .
♦ Transmembrane protein: Virion membrane
♦ Single-pass type I membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein .
♦ Surface protein: Virion membrane
♦ Peripheral membrane protein . Host endoplasmic reticulum membrane
♦ Peripheral membrane protein . Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. .
♦ Leader peptide: Virion membrane
♦ Single-pass type II membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Note=Its N-terminus is located inside the viral particle. .
♦ Transmembrane protein: Virion membrane
♦ Single-pass type I membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein .
♦ Surface protein: Virion membrane
♦ Peripheral membrane protein . Host endoplasmic reticulum membrane
♦ Peripheral membrane protein . Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. .
Not Available
MOTIF 978 980 Endoplasmic reticulum retention signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available