Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E7
Protein E7
Human Papillomavirus Type 42
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 1> Human Papillomavirus Type 42
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MRGETPTLKDIVLFDIPTCETPIDLYCYEQLDSSDEDDQAKQDIQRYRILCVCTQCYKSVKLVVQCTEADIRNLQQMLLGTLDIVCPLCARVE
93
Not Available
Not Available
01-08-1992
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Not Available
GO:0003677 ; GO:0003700 ; GO:0006351 ; GO:0030430 ; GO:0039502 ;
GO:0039645 ; GO:0042025 ; GO:0046872
GO:0039645 ; GO:0042025 ; GO:0046872
Host cytoplasm . Host nucleus . Note=Predominantly found in the host nucleus. .
Not Available
MOTIF 25 29 LXCXE motif; interaction with host RB1 and TMEM173/STING. ; MOTIF 71 79 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available