Reviewed
Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]
Not Available
10 kDa fusion protein
Orf Virus (strain NZ2) (OV NZ-2)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Parapoxvirus> Orf Virus (ORFV)> Orf Virus (strain NZ2) (OV NZ-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDENDGENLLTQPDDTGNSTNGVYAAGAPTKESVEERLVSLLDSYKTITDCCRETGNRLDRLERHLESLRKALLDLNRKIDVQTGYSRY
89
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Not Available
Not Available
Virion membrane .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available