viHumans
Reviewed
Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]
Not Available
10 kDa fusion protein
Orf Virus (strain NZ2) (OV NZ-2)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Parapoxvirus> Orf Virus (ORFV)> Orf Virus (strain NZ2) (OV NZ-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDENDGENLLTQPDDTGNSTNGVYAAGAPTKESVEERLVSLLDSYKTITDCCRETGNRLDRLERHLESLRKALLDLNRKIDVQTGYSRY
89
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
GO:0019031  ;   GO:0019062  ;   GO:0019064  ;   GO:0055036  
Virion membrane .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available