Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L2
Minor capsid protein L2
Human Papillomavirus Type 51
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 5> Human Papillomavirus Type 51
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MVATRARRRKRASVTQLYSTCKAAGTCPPDVVNKVEGTTLADKILQWSGLGIFLGGLGIGTGSGSGGRTGYIPLGGGGRPGVVDIAPARPPIIIDLWHHT
EPSIVNLVEDSSIIQSGSPIPTFTGTDGFEITSSSTTTPAVLDITPSAGTVHVSSTNIENPLYIEPPSIEAPQSGEVSDIYLLVHYSGTHGYEEIPMEVF
ASNVSTGTEPISSTPTPGVSRIAAPRLYSKSYTQVKVTNPDFISKPSTFVTFNNPAFEPIDTSITFEEPDAVAPDPDFLDIITLHRPALTSRRGTVRFSR
LGQKATMRTRSGKQIGARVHYYHDISRIAPADELEMQPLLSPSNNYSYDIYADLDEAETGFIQPTHTTPMSHSSLSRQLPSLSSSMSSSYANVTIPFSTT
YSVPIHTGPDVVLPTSPTVWPYVPHTSIDTKHSIVILGGDYYLWPYTHLLRKRRKRIPYFFTDGIVAH
EPSIVNLVEDSSIIQSGSPIPTFTGTDGFEITSSSTTTPAVLDITPSAGTVHVSSTNIENPLYIEPPSIEAPQSGEVSDIYLLVHYSGTHGYEEIPMEVF
ASNVSTGTEPISSTPTPGVSRIAAPRLYSKSYTQVKVTNPDFISKPSTFVTFNNPAFEPIDTSITFEEPDAVAPDPDFLDIITLHRPALTSRRGTVRFSR
LGQKATMRTRSGKQIGARVHYYHDISRIAPADELEMQPLLSPSNNYSYDIYADLDEAETGFIQPTHTTPMSHSSLSRQLPSLSSSMSSSYANVTIPFSTT
YSVPIHTGPDVVLPTSPTVWPYVPHTSIDTKHSIVILGGDYYLWPYTHLLRKRRKRIPYFFTDGIVAH
468
Not Available
Not Available
01-08-1992
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, L2 escorts the genomic DNA into the nucleus by promoting escape from the endosomal compartments and traffic through the host Golgi network. Plays a role through its interaction with host dynein in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to host PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.
Not Available
Virion . Host nucleus .
Not Available
MOTIF 1 12 Nuclear localization signal. ; MOTIF 449 457 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available