Reviewed
Aves [TaxID: 8782]; Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
PB1
RNA-directed RNA polymerase catalytic subunit (EC 2.7.7.48) (Polymerase basic protein 1) (PB1) (RNA-directed RNA polymerase subunit P1) (Fragment)
Influenza A Virus (strain A/Camel/Mongolia/1982 H1N1)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H1N1 Subtype> Influenza A Virus (strain A/Camel/Mongolia/1982 H1N1)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
NLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESVNNAVMMPAHGPAKNMEYDAVATTHSWVPKRNRSILNTSQRGILEDEQMYQRCCNLF
EKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFTEIMKTCSTIEELRRQK
EKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFTEIMKTCSTIEELRRQK
161
Not Available
Not Available
01-05-1992
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
RNA-dependent RNA polymerase which is responsible for replication and transcription of virus RNA segments. The transcription of viral mRNAs occurs by a unique mechanism called cap-snatching. 5' methylated caps of cellular mRNAs are cleaved after 10-13 nucleotides by PA. In turn, these short capped RNAs are used as primers by PB1 for transcription of viral mRNAs. During virus replication, PB1 initiates RNA synthesis and copy vRNA into complementary RNA (cRNA) which in turn serves as a template for the production of more vRNAs.
2.7.7.48
GO:0000166 ; GO:0003723 ; GO:0003968 ; GO:0019083 ; GO:0030430 ;
GO:0039523 ; GO:0039694 ; GO:0042025
GO:0039523 ; GO:0039694 ; GO:0042025
Host nucleus . Host cytoplasm .
Not Available
Not Available
X-ray crystallography (1)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available