viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Small delta antigen (S-HDAg) (p24)
Hepatitis Delta Virus Genotype I (isolate Japanese S-2) (HDV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Deltavirus> Hepatitis Delta Virus (HDV)> Hepatitis Delta Virus Genotype I (isolate Japanese S-2) (HDV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKARKTIKKLEEENPWLGNILGIIRKGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKERE
DHRRRKALENKKKQLSAGGKILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFSRTGEGLDIRGTQGFP
195
Not Available
Not Available
14-04-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome (By similarity).
Not Available
GO:0003723  ;   GO:0019012  ;   GO:0042025  ;   GO:0046718  ;   GO:0075732  
Virion. Host nucleus .
DOMAIN 21 195 HDAg.
MOTIF 66 75 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available