Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L4[Gene ID: 2653005 ]
Protein 33K (L4-33K) (Splicing factor 33K) (Terminase, small subunit)
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAPKKKLQLPPPPPTDEEEYWDSQAEEVLDEEEEMMEDWDSLDEASEAEEVSDETPSPSVAFPSPAPQKLATVPSIATTSAPQAPPALPVRRPNRRWDTT
GTRAAPTAPAAAAAAATAAVTQKQRRPDSKTLTKPKKSTAAAAAGGGALRLAPNEPVSTRELRNRIFPTLYAIFQQSRGQEQELKIKNRSLRSLTRSCLY
HKSEDQLRRTLEDAEALFSKYCALTLKD
GTRAAPTAPAAAAAAATAAVTQKQRRPDSKTLTKPKKSTAAAAAGGGALRLAPNEPVSTRELRNRIFPTLYAIFQQSRGQEQELKIKNRSLRSLTRSCLY
HKSEDQLRRTLEDAEALFSKYCALTLKD
228
Not Available
Not Available
01-03-1992
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Promotes alternative splicing of late transcripts by promoting splicing at weak 3' splice sites. Required for the temporal activation of major late pre-mRNA splicing at late times of infection. Induces the splicing and expression of the late capsid vertex protein.
♦ Probably functions as the small terminase that is part of the molecular motor that translocates genomic DNA in empty capsid during DNA packaging. This motor is located at a unique vertex and comprises at least the IVa2 ATPase, the small terminase 33K and probably a portal. Forms a ring-like structure of about 17 nm in which genomic DNA is translocated into the capsid. Stimulates IVa2 ATPase activity in the presence of the viral genome. Once the DNA is packaged, the terminase detaches: the 33K protein is present in the empty particles, but not in the mature virions. Also involved in virion assembly.
♦ Probably functions as the small terminase that is part of the molecular motor that translocates genomic DNA in empty capsid during DNA packaging. This motor is located at a unique vertex and comprises at least the IVa2 ATPase, the small terminase 33K and probably a portal. Forms a ring-like structure of about 17 nm in which genomic DNA is translocated into the capsid. Stimulates IVa2 ATPase activity in the presence of the viral genome. Once the DNA is packaged, the terminase detaches: the 33K protein is present in the empty particles, but not in the mature virions. Also involved in virion assembly.
Not Available
Host nucleus . Note=At late time of infection, reorganized from the nuclear margin to ring-like structures at viral replication centers. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available