Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L3
♦Pre-protein VI (pVI) [Cleaved into: Endosome lysis protein
♦ Protease cofactor (pVI-C)]
♦ Protease cofactor (pVI-C)]
Human Adenovirus C Serotype 5 (HAdV-5) (Human Adenovirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 5 (HAdV-5) (Human Adenovirus 5)
Various pathway(s) in which protein is involved
Not Available
Not Available
MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGIKNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQ
NKINSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLPTTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTA
VVVTRPSRASLRRAASGPRSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF
NKINSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLPTTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTA
VVVTRPSRASLRRAASGPRSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF
250
Not Available
Not Available
01-03-1992
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Pre-protein VI: During virus assembly, promotes hexon trimers nuclear import through nuclear pore complexes via an importin alpha/beta-dependent mechanism. By analogy to herpesviruses capsid assembly, might act as a chaperone to promote the formation of the icosahedral capsid.
♦ Endosome lysis protein: Structural component of the virion that provides increased stability to the particle shell through its interaction with the core-capsid bridging protein and the hexon-linking protein VIII (PubMed:25071205). Fibers shedding during virus entry into host cell allows the endosome lysis protein to be exposed as a membrane-lytic peptide (By similarity). Exhibits pH-independent membrane fragmentation activity and probably mediates viral rapid escape from host endosome via organellar membrane lysis (PubMed:15681401, PubMed:21209115, PubMed:20409568, PubMed:22516138). It is not clear if it then remains partially associated with the capsid and involved in the intracellular microtubule-dependent transport of capsid to the nucleus, or if it is lost during endosomal penetration (PubMed:20333243).
♦ Protease cofactor: Cofactor that activates the viral protease. Binds to viral protease in a 1:1 ratio.
♦ Endosome lysis protein: Structural component of the virion that provides increased stability to the particle shell through its interaction with the core-capsid bridging protein and the hexon-linking protein VIII (PubMed:25071205). Fibers shedding during virus entry into host cell allows the endosome lysis protein to be exposed as a membrane-lytic peptide (By similarity). Exhibits pH-independent membrane fragmentation activity and probably mediates viral rapid escape from host endosome via organellar membrane lysis (PubMed:15681401, PubMed:21209115, PubMed:20409568, PubMed:22516138). It is not clear if it then remains partially associated with the capsid and involved in the intracellular microtubule-dependent transport of capsid to the nucleus, or if it is lost during endosomal penetration (PubMed:20333243).
♦ Protease cofactor: Cofactor that activates the viral protease. Binds to viral protease in a 1:1 ratio.
Not Available
♦ Pre-protein VI: Host nucleus , . Host cytoplasm , . Note=Shuttles between host cytoplasm and nucleus. , .
♦ Endosome lysis protein: Virion , . Note=Associates with the base of each peripentonal hexon on the capsid interior. Present in around 360 copies per virion. , .
♦ Endosome lysis protein: Virion , . Note=Associates with the base of each peripentonal hexon on the capsid interior. Present in around 360 copies per virion. , .
Not Available
MOTIF 67 76 Nuclear export signal. ; MOTIF 131 135 Nuclear localization signal. ; MOTIF 148 151 PPXY motif. ; MOTIF 231 242 Nuclear export signal. ; MOTIF 245 248 Nuclear localization signal.
X-ray crystallography (1)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available