viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L3
♦Pre-protein VI (pVI) [Cleaved into: Endosome lysis protein
♦ Protease cofactor (pVI-C)]
Human Adenovirus C Serotype 5 (HAdV-5) (Human Adenovirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 5 (HAdV-5) (Human Adenovirus 5)
AC_000008.1 ;   
Various pathway(s) in which protein is involved
Not Available
Not Available
MEDINFASLAPRHGSRPFMGNWQDIGTSNMSGGAFSWGSLWSGIKNFGSTVKNYGSKAWNSSTGQMLRDKLKEQNFQQKVVDGLASGISGVVDLANQAVQ
NKINSKLDPRPPVEEPPPAVETVSPEGRGEKRPRPDREETLVTQIDEPPSYEEALKQGLPTTRPIAPMATGVLGQHTPVTLDLPPPADTQQKPVLPGPTA
VVVTRPSRASLRRAASGPRSLRPVASGNWQSTLNSIVGLGVQSLKRRRCF
250
Not Available
Not Available
01-03-1992
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Pre-protein VI: During virus assembly, promotes hexon trimers nuclear import through nuclear pore complexes via an importin alpha/beta-dependent mechanism. By analogy to herpesviruses capsid assembly, might act as a chaperone to promote the formation of the icosahedral capsid.
♦ Endosome lysis protein: Structural component of the virion that provides increased stability to the particle shell through its interaction with the core-capsid bridging protein and the hexon-linking protein VIII (PubMed:25071205). Fibers shedding during virus entry into host cell allows the endosome lysis protein to be exposed as a membrane-lytic peptide (By similarity). Exhibits pH-independent membrane fragmentation activity and probably mediates viral rapid escape from host endosome via organellar membrane lysis (PubMed:15681401, PubMed:21209115, PubMed:20409568, PubMed:22516138). It is not clear if it then remains partially associated with the capsid and involved in the intracellular microtubule-dependent transport of capsid to the nucleus, or if it is lost during endosomal penetration (PubMed:20333243).
♦ Protease cofactor: Cofactor that activates the viral protease. Binds to viral protease in a 1:1 ratio.
Not Available
GO:0019012  ;   GO:0019028  ;   GO:0030430  ;   GO:0039664  ;   GO:0042025  ;  
GO:0046729  ;   GO:0075521  
♦ Pre-protein VI: Host nucleus , . Host cytoplasm , . Note=Shuttles between host cytoplasm and nucleus. , .
♦ Endosome lysis protein: Virion , . Note=Associates with the base of each peripentonal hexon on the capsid interior. Present in around 360 copies per virion. , .
Not Available
MOTIF 67 76 Nuclear export signal. ; MOTIF 131 135 Nuclear localization signal. ; MOTIF 148 151 PPXY motif. ; MOTIF 231 242 Nuclear export signal. ; MOTIF 245 248 Nuclear localization signal.
X-ray crystallography (1)
4CWU  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available