Reviewed
Homo Sapiens (Human) [TaxID: 9606]
1B NS2
Non-structural protein 2 (NS2) (Non-structural protein 1B)
Human Respiratory Syncytial Virus B (strain 18537)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus B> Human Respiratory Syncytial Virus B (strain 18537)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSTTNDNTTMQRLMITDMRPLSMESIITSLTKEIITHKFIYLINNECIVRKLDERQATFTFLVNYEMKLLHKVGSTIYKKYTEYNTKYGTFPMPIFINHD
GFLECIGIKPTKHTPIIYKYDLNP
GFLECIGIKPTKHTPIIYKYDLNP
124
Not Available
Not Available
01-03-1992
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in antagonizing the type I IFN-mediated antiviral response. Acts cooperatively with NS1 to repress activation and nuclear translocation of host IFN-regulatory factor IRF-3. Interacts with the host cytoplasmic sensor of viral nucleic acids DDX58/RIG-I and prevents the interaction with its downstream partner MAVS. Mediates the proteasomal degradation of host STAT2 with Elongin-Cullin E3 ligase. Induces activation of NF-kappa-B. Suppresses premature apoptosis by an NF-kappa-B-dependent, interferon-independent mechanism and thus facilitates virus growth. May also inhibit viral transcription and RNA replication (By similarity).
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available