viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Rev
Protein Rev (Regulator of expression of viral proteins)
Human Immunodeficiency Virus Type 2 Subtype A (isolate CAM2) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> Human Immunodeficiency Virus Type 2 Subtype A (isolate CAM2) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MTERADEEGLQRKLRLIRLLHQTNPYPQGPGTASQRRNRRRRWRQRWRQILALADRIYTFPDPPADPPLDRTIQHLQELTIQDLPDPPTHPPESQRLAEA
100
Not Available
Not Available
01-03-1992
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Escorts unspliced or incompletely spliced viral pre-mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, that is not present in fully spliced viral mRNAs (early transcripts). This function is essential since most viral proteins are translated from unspliced or partially spliced pre-mRNAs which cannot exit the nucleus by the pathway used by fully processed cellular mRNAs (By similarity).
Not Available
GO:0003700  ;   GO:0003723  ;   GO:0030430  ;   GO:0044196  ;   GO:0051028  
Host nucleus, host nucleolus. Host cytoplasm. Note=The presence of both nuclear import and nuclear export signals leads to continuous shuttling between the nucleus and cytoplasm. .
Not Available
MOTIF 35 49 Nuclear localization signal and RNA-binding (RRE). ; MOTIF 71 82 Nuclear export signal and binding to XPO1.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available