viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GK UL53
Envelope glycoprotein K (Syncytial protein)
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MLAVRSLQHLTTVIFITAYGLVLAWYIVFGASPLHRCIYAVRPAGAHNDTALVWMKINQTLLFLGPPTAPPGGAWTPHARVCYANIIEGRAVSLPAIPGA
MSRRVMNVHEAVNCLEALWDTQMRLVVVGWFLYLAFVALHQRRCMFGVVSPAHSMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQTLVQLF
EADPVTFLYHRPAIGVIVGCELLLRFVALGLIVGTALISRGACAITHPLFLTITTWCFVSIIALTELYFILRRGSAPKNAEPAAPRGRSKGWSGVCGRCC
SIILSGIAVRLCYIAVVAGVVLVALRYEQEIQRRLFDL
338
Not Available
Not Available
07-06-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Glycoprotein that probably modulates membrane fusion events during secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes. Also plays a role, together with gB, in virus-induced cell-to-cell fusion (syncytia formation). Seems to block fusion of virions with infected-cell membranes (By similarity).
Not Available
GO:0016021  ;   GO:0020002  ;   GO:0039700  ;   GO:0044175  ;   GO:0044178  ;  
GO:0060141  
♦ Host cell membrane
♦ Multi-pass membrane protein . Host endosome membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with UL20 to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). Cell surface expression of gK is required for virus-induced cell-to-cell fusion. Likely not present in extracellular virions (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available