viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E4
Protein E4
Human Papillomavirus Type 47
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Betapapillomavirus> Betapapillomavirus 1> Human Papillomavirus Type 47
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MADSKAPHHQGHQEDKQTQTPPPRPPPPPQPPLTPRPDANPSINSHNKPKPNEEGTDGDHQAEQGDRKRTKGDPDPDPGRGPVLKPTLPPPPPPPPTGPG
LRRSTRLVLVPGQGPPPDLPAPPVEGEVEGHPQGKDRDHPPPTPQNGHGKETQGAEGGGDKGEQGAVGGESSDGEGDHSQPPLTPPNESDGSLLNTVACL
LARWESNFDQLVQNIQGDLEGYWRKLGTPQ
230
Not Available
Not Available
18-01-2017
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.
Not Available
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available