viHumans
Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Bos Taurus X Bison Bison (beefalo) [TaxID: 297284]; Camelus Bactrianus (Bactrian Camel) [TaxID: 9837]; Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]
N
Nucleoprotein (Nucleocapsid protein) (Protein N)
Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Phenuiviridae> Phlebovirus> Rift Valley Fever Phlebovirus> Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRD
ELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPM
NAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
245
Not Available
Not Available
01-05-1991
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles.
Not Available
Virion. Note=Internal protein of virus particle.
Not Available
Not Available
X-ray crystallography (2)
3OUO  3OV9  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available