Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Bos Taurus X Bison Bison (beefalo) [TaxID: 297284]; Camelus Bactrianus (Bactrian Camel) [TaxID: 9837]; Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]
N
Nucleoprotein (Nucleocapsid protein) (Protein N)
Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Phenuiviridae> Phlebovirus> Rift Valley Fever Phlebovirus> Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRD
ELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPM
NAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
ELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPM
NAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
245
Not Available
Not Available
01-05-1991
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles.
Not Available
Virion. Note=Internal protein of virus particle.
Not Available
Not Available
X-ray crystallography (2)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available