viHumans
Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Bos Taurus X Bison Bison (beefalo) [TaxID: 297284]; Camelus Bactrianus (Bactrian Camel) [TaxID: 9837]; Capra Hircus (Goat) [TaxID: 9925]; Homo Sapiens (Human) [TaxID: 9606]; Ovis Aries (Sheep) [TaxID: 9940]; Phlebotomus Papatasi (Sandfly) [TaxID: 29031]
NSS
Non-structural protein S (NSs)
Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Phenuiviridae> Phlebovirus> Rift Valley Fever Phlebovirus> Rift Valley Fever Virus (strain ZH-548 M12) (RVFV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDYFPVISVDLQSGRRVVSVEYFRGDGPPRIPYSMVGPCCVFLMHHRPSHEVRLRFSDFYNVGEFPYRVGLGDFASNVAPPPAKPFQRLIDLIGHMTLSD
FTRFPNLKEAISWPLGEPSLAFFDLSSTRVHRNDDIRRDQIATLAMRSCKITNDLEDSFAGLHRMIATEAILRGIDLCLLPGFDLMYEVAHVQCVRLLQA
AKEDISNAVVPNSALIVLMEESLMLRSSLPSMMGRNNWIPVIPPIPDVEMESEEESDDDGFVEVD
265
Not Available
Not Available
01-05-1991
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the escape of host innate immune response by promoting the degradation of host EIF2AK2/PKR and inhibiting host transcription. Cytoplasmic NSs interacts with host FBXW11 to degrade PKR whereas nuclear pool binds to host FBXO3 to target TFIIH subunit GTF2H1 for proteasomal degradation.
Not Available
GO:0030430  ;   GO:0039501  ;   GO:0039502  ;   GO:0039580  ;   GO:0039602  ;  
GO:0039653  ;   GO:0039657  ;   GO:0039689  ;   GO:0042025  
Host nucleus . Host cytoplasm .
Not Available
Not Available
NMR spectroscopy (1)
2N0Y  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available