viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
RPO35 A29L
DNA-directed RNA polymerase 35 kDa subunit (EC 2.7.7.6)
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MQHPREENSIVVELEPSLATFIKQGFNNLVKWPLLNIGIVLSNTSTAVNEEWLTAVEHIPTMKIFYKHIHKILTREMGFLVYLKRSQSERDNYITLYDFD
YYIIDKDTNSVTMVDKPTELKETLLHVFQEYRLKSSQTIELIAFSSGTVINEDIVSKLTFLDVEVFNREYNNVKTIIDPDFVFRSPFIVISPMGKLTFFV
EVYSWFDFKSCFKDIIDFLEGALIANIHNHMIKVGDCDETVSSYNPESGMLFVNDLMTMNIVNFFGCNSRLESYHRFDMTKVDVELFIKALSDACKKILS
ASNRL
305
Not Available
Not Available
01-02-1991
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Part of the DNA-dependent RNA polymerase which catalyzes the transcription of viral DNA into RNA using the four ribonucleoside triphosphates as substrates. Responsible for the transcription of early, intermediate and late genes. DNA-dependent RNA polymerase associates with the early transcription factor (ETF), itself composed of D6 and A7, thereby allowing the early genes transcription. Late transcription, and probably also intermediate transcription, require newly synthesized RNA polymerase.
2.7.7.6  
GO:0003677  ;   GO:0003899  ;   GO:0019012  ;   GO:0019083  
Virion . Note=All the enzymes and other proteins required to synthesize early mRNAs are packaged within the virion core along with the DNA genome. This is necessary because viral early mRNAs are synthesized within minutes after virus entry into the cell and are extruded through pores in the core particle.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available