viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E3L
Protein E3 (p25)
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKS
FDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF
190
VAR_SEQ 1 37 Missing (in isoform Short)
Not Available
01-02-1991
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein (By similarity).
Not Available
GO:0003723  ;   GO:0003726  ;   GO:0039502  ;   GO:0039548  ;   GO:0039557  ;  
GO:0039579  ;   GO:0039580  
Not Available
DOMAIN 117 184 DRBM.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available