Reviewed
Homo Sapiens (Human) [TaxID: 9606]
J1R
Protein J1
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
2219722 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MDHNQYLLTMFFADDDSFFKYLASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNK
GYLFDFVISLMRFKKESSLATTAIDPIRYIDPRRDIAFSNVMDILKSNKVNNN
GYLFDFVISLMRFKKESSLATTAIDPIRYIDPRRDIAFSNVMDILKSNKVNNN
153
Not Available
Not Available
01-02-1991
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions. J1 protein is required for DNA packaging during immature virions (IV) formation (By similarity).
Not Available
Virion. Host cytoplasm . Note=Localizes in cytoplasmic virus factories. Probably located in between the core and the virion membrane (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available