viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
D10R
mRNA-decapping protein D10 (EC 3.1.3.-)
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MNFYRSSIISQIIKYNRRLAKSIICEDDSQIITLTAFVNQCLWCHKRVSVSAILLTTDNKILVCNRRDSFLYSEIIRTRNMFRKKRLFLNYSNYLSKQER
SILSSFFSLYPATADNDRIDAIYPGGIPKRGENVPECLSREIKEEVNIDNSFVFIDTRFFIHGIIEDTIINKFFEVIFFVGRISLTSDQIIDTFKSNHEI
KDLIFLDPNSGNGLQYEIAKYALDTAKLKCYGHRGCYYESLKKLTEDD
248
Not Available
Not Available
01-02-1991
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Decapping enzyme required for the removal of the 5'-end m7GpppN cap tethered to viral and host mRNAs to allow their decay in cells. May therefore accelerate viral and cellular mRNA turnover to eliminate competing host mRNAs and allow stage-specific synthesis of viral proteins. Acceleration of the turnover of cellular transcripts may even promote the shutoff of host protein synthesis (By similarity).
3.1.3.-  
Not Available
DOMAIN 45 227 Nudix hydrolase.
MOTIF 126 147 Nudix box.
Predicted/Modelled
Not Available
ACT_SITE 141 141 Nucleophile.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available