viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
HA A56R
Protein A56 (Hemagglutinin)
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MTRLPILLLLISLVYATPFPQTSKKIGDDATLSCNRNNTNDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDKISYDSPYDDLVTTITIKSLTARDAGT
YVCAFFMTSPTNDTDKVDYEEYSTELIVNTDSESTIDIILSGSTHSPETSSEKPDYIDNSNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSATSG
ESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDTVPSTTVGSSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYY
ICNKRSRKYKTENKV
315
Not Available
Not Available
01-02-1991
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Prevents cell to cell fusion by interacting with and directing the viral K2 protein on the host plasma membrane. The A56-K2 complex associates with components of the entry fusion complex (EFC) presumably to avoid superinfection and syncytium formation. Via its interaction with C3/VCP protein, protects the infected cell and probably also the extracellular enveloped virus from complement attack (By similarity).
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0033644  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type I membrane protein . Host membrane
♦ Single-pass type I membrane protein . Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Component of the outermost membrane of EEV.
DOMAIN 17 121 Ig-like V-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available