Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Tat
Protein Tat (Transactivating regulatory protein)
Human Immunodeficiency Virus Type 2 Subtype A (isolate ST) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> HIV-2 Subtype A> Human Immunodeficiency Virus Type 2 Subtype A (isolate ST) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
METPLKAPEGSLGSYNEPSSCTSEQDAAAQGLVSPGDEILYQLYQPLEACDNKCYCKKCCYHCQMCFLNKGLGIWYERKGRRRRTPKKTKAHSSSASDKS
ISTRTGNSQPEKKQKKTLETALETIGGPGR
ISTRTGNSQPEKKQKKTLETALETIGGPGR
130
VAR_SEQ 100 130 Missing (in isoform Short)
Not Available
01-02-1991
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Nuclear transcriptional activator of viral gene expression, that is essential for viral transcription from the LTR promoter and replication. Acts as a sequence-specific molecular adapter, directing components of the cellular transcription machinery to the viral RNA to promote processive transcription elongation by the RNA polymerase II (RNA pol II) complex, thereby increasing the level of full-length transcripts. In the absence of Tat, the RNA Pol II generates short or non-processive transcripts that terminate at approximately 60 bp from the initiation site. Tat associates with the CCNT1/cyclin-T1 component of the P-TEFb complex (CDK9 and CCNT1), which promotes RNA chain elongation. This binding increases Tat's affinity for a hairpin structure at the 5'-end of all nascent viral mRNAs referred to as the transactivation responsive RNA element (TAR RNA) and allows Tat/P-TEFb complex to bind cooperatively to TAR RNA. The CDK9 component of P-TEFb and other Tat-activated kinases hyperphosphorylate the C-terminus of RNA Pol II that becomes stabilized and much more processive (By similarity).
♦ Extracellular circulating Tat can be endocytosed by surrounding uninfected cells via the binding to several surface receptors. Endosomal low pH allows Tat to cross the endosome membrane to enter the cytosol and eventually further translocate into the nucleus, thereby inducing severe cell dysfunctions ranging from cell activation to cell death. Through (By similarity).
♦ Extracellular circulating Tat can be endocytosed by surrounding uninfected cells via the binding to several surface receptors. Endosomal low pH allows Tat to cross the endosome membrane to enter the cytosol and eventually further translocate into the nucleus, thereby inducing severe cell dysfunctions ranging from cell activation to cell death. Through (By similarity).
Not Available
Host nucleus, host nucleolus .
Not Available
MOTIF 78 90 Nuclear localization signal, and RNA-binding (TAR).
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available