viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
H5R
Late transcription elongation factor H5 (Viral late gene transcription factor 4) (VLTF-4)
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAWSITNKADTSSFTKMAEIRAHLKNSAENKDKNEDIFPEDVIIPSTKPKTKRATTPRKPAATKRSTKKEEVEEEVVIEEYHQTTEKNSPSPGVGDIVES
VAAVELDDSDGDDEPMVQVEAGKVNHSARSDLSDLKVATDNIVKDLKKIITRISAVSTVLEDVQAAGISRQFTSMTKAITTLSDLVTEGKSKVVRKKVKT
CKK
203
Not Available
Not Available
01-02-1991
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Involved in the co-transcriptional or post-transcriptional endoribonucleolytic cleavage that generates sequence-homogeneous 3' ends during late transcription. Involved in postreplicative transcription elongation on intermediate and late genes (Probable). Also involved in DNA replication and in multiple steps of virion morphogenesis. Required both for inclusion of virosoplasm into crescents as well as for maturation of immature virions (IV) into mature virions (MV) (By similarity).
Not Available
GO:0003746  ;   GO:0006351  ;   GO:0006355  ;   GO:0019031  ;   GO:0030430  
Virion . Host cytoplasm . Note=Early during viral infection, diffusely localizes within the cytoplasm. Following DNA replication, localizes specifically to virus factories (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available