Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E6
Protein E6
Human Papillomavirus Type 43
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 8> Human Papillomavirus Type 43
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSARSCSQNARTIFELCDECNITLPTLQIGCIFCKKWLLTTEVLSFAFRDLRVVWRDGYPFAACLACLQFHGKISQYRHFDYAAYADTVEEETKQTVFDL
CIRCCKCHKPLSPVEKVQHIVQKAQFFKIHSVWKGYCLHCWKSCMEKRRRSETMC
CIRCCKCHKPLSPVEKVQHIVQKAQFFKIHSVWKGYCLHCWKSCMEKRRRSETMC
155
Not Available
Not Available
01-02-1991
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦This protein may be involved in the oncogenic potential of this virus (cervical neoplasia-associated virus).
♦ Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Sequesters tumor suppressor TP53 in the host cytoplasm and modulates its activity by interacting with host EP300 that results in the reduction of TP53 acetylation and activation. In turn, apoptosis induced by DNA damage is inhibited. E6 protects also host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response.
♦ Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Sequesters tumor suppressor TP53 in the host cytoplasm and modulates its activity by interacting with host EP300 that results in the reduction of TP53 acetylation and activation. In turn, apoptosis induced by DNA damage is inhibited. E6 protects also host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response.
Not Available
GO:0003677 ; GO:0006351 ; GO:0006355 ; GO:0030430 ; GO:0039503 ;
GO:0039526 ; GO:0042025 ; GO:0046872
GO:0039526 ; GO:0042025 ; GO:0046872
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available