Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mesocricetus Auratus (Golden Hamster) [TaxID: 10036]; Mus Musculus (Mouse) [TaxID: 10090]
Z
RING finger protein Z (Protein Z) (Zinc-binding protein) (Fragment)
Lymphocytic Choriomeningitis Virus (strain Traub) (LCMV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Lymphocytic Choriomeningitis Mammarenavirus> Lymphocytic Choriomeningitis Virus (strain Traub) (LCMV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGQSKSKEEKGISGTSRAEILPDTTYLGPLNCKSCWQKFDSFSKCHDHYLCRHCLNLLLTSSDRCPLCKYPL
72
Not Available
Not Available
23-01-2007
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z (By similarity).
Not Available
♦ Virion. Host cytoplasm, host perinuclear region. Host cell membrane
♦ Lipid-anchor
♦ Cytoplasmic side. Note=Mainly perinuclear. During budding, associates at the inner side of the plasma membrane of infected cells (By similarity). .
♦ Lipid-anchor
♦ Cytoplasmic side. Note=Mainly perinuclear. During budding, associates at the inner side of the plasma membrane of infected cells (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available