Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mesocricetus Auratus (Golden Hamster) [TaxID: 10036]; Mus Musculus (Mouse) [TaxID: 10090]
Z Segment L
RING finger protein Z (Protein Z) (Zinc-binding protein)
Lymphocytic Choriomeningitis Virus (strain Armstrong) (LCMV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Lymphocytic Choriomeningitis Mammarenavirus> Lymphocytic Choriomeningitis Virus (strain Armstrong) (LCMV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGQGKSREEKGTNSTNRAEILPDTTYLGPLSCKSCWQKFDSLVRCHDHYLCRHCLNLLLSVSDRCPLCKYPLPTRLKISTAPSSPPPYEE
90
Not Available
Not Available
23-01-2007
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays a crucial role in virion assembly and budding. Expressed late in the virus life cycle, it acts as an inhibitor of viral transcription and RNA synthesis by interacting with the viral polymerase L. Presumably recruits the NP encapsidated genome to cellular membranes at budding sites via direct interaction with NP. Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. The budding of the virus progeny occurs after association of protein Z with the viral glycoprotein complex SSP-GP1-GP2 at the cell periphery, step that requires myristoylation of protein Z. Also selectively represses protein production by associating with host eIF4E.
Not Available
GO:0003723 ; GO:0008270 ; GO:0016020 ; GO:0019012 ; GO:0020002 ;
GO:0039702 ; GO:0044220 ; GO:0046761
GO:0039702 ; GO:0044220 ; GO:0046761
♦ Virion . Host cytoplasm, host perinuclear region . Host cell membrane
♦ Lipid-anchor
♦ Cytoplasmic side . Note=Mainly perinuclear. During budding, associates at the inner side of the plasma membrane of infected cells. .
♦ Lipid-anchor
♦ Cytoplasmic side . Note=Mainly perinuclear. During budding, associates at the inner side of the plasma membrane of infected cells. .
Not Available
MOTIF 85 88 PPXY motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available