viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Nef
Protein Nef (3'ORF) (Negative factor) (F-protein)
Human Immunodeficiency Virus Type 2 Subtype A (isolate Ghana-1) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> Human Immunodeficiency Virus Type 2 Subtype A (isolate Ghana-1) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGASGSKKHSKHSQRLRERLLRAHGGGYVQQCNASGGEYSQSQEGSGKGQKSPSCEGQQYRQGDFMNTPWRTPAIEGQKKLYKQQNMDDIDSSDDDLVGV
PVTPRVPLRAMTYKLAVDMSHFIKKRGLDGMFYSRDRHRILDLYLEKEEGIIPDWQNYTHGPGVRYPMCFGWLWKLVPVDVSQEAEDDETNYLTHPAQTS
RHDDEHGETLLWRFDPTLAYDYKAFILHPEEFGHKSGLPEKEWKAKLKARGIPYS
255
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Factor of infectivity and pathogenicity, required for optimal virus replication. Alters numerous pathways of T-lymphocytes function and down-regulates immunity surface molecules in order to evade host defense and increase viral infectivity. Alters the functionality of other immunity cells, like dendritic cells, monocytes/macrophages and NK cells. One of the earliest and most abundantly expressed viral proteins (By similarity).
♦ In infected CD4(+) T-lymphocytes, down-regulates cell surface expression of CD4, CD28, CD3, and MHC-I or MHC-II molecules.
♦ Interferes with TCR signaling from the cell membrane. Interacts with CD247/TCRZ (TCR zeta chain) and exert potent down-regulation of cell surface TCR/CD3 complexes.
♦ Plays a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Protects the infected cells from apoptosis in order to keep them alive until the next virus generation is ready to strike (By similarity).
♦ Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.
Not Available
GO:0005525  ;   GO:0009405  ;   GO:0016020  ;   GO:0020002  ;   GO:0030683  
♦ Host cell membrane
♦ Lipid-anchor
♦ Cytoplasmic side . Note=Associates with the inner plasma membrane through its N-terminal domain. .
Not Available
MOTIF 104 107 PxxP.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available