Reviewed
Aedes [TaxID: 7158]; Culex Annulirostris (Common Banded Mosquito) [TaxID: 162997]; Homo Sapiens (Human) [TaxID: 9606]; Macropus Sp. (kangaroo) [TaxID: 9322]
Not Available
Structural polyprotein [Cleaved into: Spike glycoprotein E2 (E2 envelope glycoprotein)] (Fragment)
Ross River Virus (strain 213970) (RRV)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Togaviridae> Alphavirus (arboviruses Group A)> Ross River Virus> Ross River Virus (strain 213970) (RRV)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
SVTEHFNVYKATRPYXXXCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKLRYMAGHDVQESKRDSLRVYTSAACSIHGTMGHF
IVAHCPPGDYLKVSFEDADSHVKACKVQYKHNPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYN
CTWGRDNVGTTSTDKTINACKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLG
AEPHPYEEWVDKFSERIIPVTEEGXEYQWGNNPPVRLWAXLTTEGKPHGWPHEIIQYYYGLYPAATIAAVSGXSLMALLTLAATCCMLATARRKCLTPYA
LTPGAVVPLTLGLXXCAPRANA
IVAHCPPGDYLKVSFEDADSHVKACKVQYKHNPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYN
CTWGRDNVGTTSTDKTINACKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLG
AEPHPYEEWVDKFSERIIPVTEEGXEYQWGNNPPVRLWAXLTTEGKPHGWPHEIIQYYYGLYPAATIAAVSGXSLMALLTLAATCCMLATARRKCLTPYA
LTPGAVVPLTLGLXXCAPRANA
422
Not Available
Not Available
01-08-1990
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Spike glycoprotein E2: Plays a role in viral attachment to target host cell, by binding to the cell receptor. Synthesized as a p62 precursor which is processed by furin at the cell membrane just before virion budding, giving rise to E2-E1 heterodimer. The p62-E1 heterodimer is stable, whereas E2-E1 is unstable and dissociate at low pH. p62 is processed at the last step, presumably to avoid E1 fusion activation before its final export to cell surface. E2 C-terminus contains a transitory transmembrane that would be disrupted by palmitoylation, resulting in reorientation of the C-terminal tail from lumenal to cytoplasmic side. This step is critical since E2 C-terminus is involved in budding by interacting with capsid proteins. This release of E2 C-terminus in cytoplasm occurs lately in protein export, and precludes premature assembly of particles at the endoplasmic reticulum membrane.
Not Available
♦ Spike glycoprotein E2: Virion membrane JUX5
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein JUX5.
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein JUX5.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available