viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Fiber protein 2
Human Adenovirus F Serotype 41 (HAdV-41) (Human Adenovirus 41)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 41 (HAdV-41) (Human Adenovirus 41)
AC_000019.1 ;   
Various pathway(s) in which protein is involved
Not Available
Not Available
MKRTRIEDDFNPVYPYDTFSTPSIPYVAPPFVSSDGLQEKPPGVLALKYTDPITTNAKHELTLKLGSNITLENGLLSATVPTVSPPLTNSNNSLGLATSA
PIAVSANSLTLATAAPLTVSNNQLSINAGRGLVITNNALTVNPTGALGFNNTGALQLNAAGGMRVDGANLILHVAYPFEAINQLTLRLENGLEVTSGGKL
NVKLGSGLQFDSNGRIAISNSNRTRSVPSLTTIWSISPTPNCSIYETQDANLFLCLTKNGAHVLGTITIKGLKGALREMHDNALSLKLPFDNQGNLLNCA
LESSTWRYQETNAVASNALTFMPNSTVYPRNKTAHPGNMLIQISPNITFSVVYNEINSGYAFTFKWSAEPGKPFHPPTAVFCYITEQ
387
Not Available
Not Available
01-08-1990
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Forms spikes that protrude from each vertex of the icosahedral capsid. Interacts with host receptor CXCAR to provide virion initial attachment to target cell. Fiber proteins are shed during virus entry, when virus is still at the cell surface (By similarity).
Not Available
GO:0007155  ;   GO:0019028  ;   GO:0042025  ;   GO:0046718  ;   GO:0098671  
Virion . Host nucleus . Note=Anchored to the pentons, protrudes from the virion surface. .
Not Available
Not Available
X-ray crystallography (2)
2BZU  2BZV  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available