viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL38
Apoptosis inhibitor UL38
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MTTTTHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYAVRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVI
EAWEEASVRPTRQLVLFMTPKWDVFAYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEVRSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPR
TFAKSVNSYVRAILESERRIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPLPVSEEDPAAAATPSSSAATTPPSSVVPASVESE
LSSSPPLPPVVVKDVVYTAGEGDVVQMVVVV
331
Not Available
Not Available
01-08-1990
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host apoptosis to facilitate efficient viral replication. Promotes stabilization and inactivation of host TP53 through interaction with host MDM2 (By similarity). Induces host mTORC1 activation by antagonizing the ability of host TSC1/2 to negatively regulate mTORC1. Thus, inhibits a growth regulatory pathway to facilitate viral replication (By similarity).
Not Available
Host cytoplasm HG98. Host nucleus HG98. Note=localized in the host nucleus at early times postinfection and then increases in both nuclear and cytoplasmic compartments during the course of infection. HG98.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available