viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL37
UL37 immediate early glycoprotein
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEER
EDEEEENEARTPEVNPIDAEGLSGLAREACEALKKALRRHRFLWQRRQRARMLQHNGPQQSHHAAVFCRVHGLRGFQVSVWLLLTLLWSTGHGVSVRCTY
HGTDVNRTSNTTSMNCHLNCTRNHTQIYNGPCLGTEARLPLNVTFNQSRRKWHSVMLKFGFQYHLEGWFPLRVLNESREINVTEVHGEVACFRNDTNVTV
GQLTLNFTGHSYVLRAIAHTSPFESYVRWEETNVTDNATSSENTTTVMSTLTKYAESDYIFLQDMCPRFLKRTVKLTRNKTKHNVTVTGNNMTTLPVWTP
ECKGWTYWTTLSVMWRNRRSALLRAKSRALGHWALLSICTVAAGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHRIV
487
VAR_SEQ 163 163 H -> Q (in isoform vMIA) ; VAR_SEQ 164 487 Missing (in isoform vMIA) ; VAR_SEQ 178 262 Missing (in isoform pUL37m)
Not Available
30-05-2000
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Isoform vMIA sequesters proapoptotic BAX at the outer mitochondrial membrane and prevents cytochrome c release and subsequent initiation of the proapoptotic cascade. Also provoques a calcium efflux from host endoplasmic reticulum and F-actin cytoskeleton disruption. Participates in the increase of host mitochondrial biogenesis, thus promoting viral replication by efficient use of newly made mitochondria.
♦ Isoform gpUL37 may play a role in escape from the host antiviral response.
Not Available
GO:0016021  ;   GO:0039526  ;   GO:0044167  ;   GO:0044178  ;   GO:0044191  
♦ Isoform gpUL37: Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Host Golgi apparatus membrane
♦ Single-pass membrane protein . Host mitochondrion membrane
♦ Single-pass membrane protein . Note=The C-terminal fragment localizes to the endoplasmic reticulum while the N-terminal fragment is stable and traffics to mitochondria.
♦ Isoform vMIA: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Transported from the endoplasmic reticulum (ER) through the mitochondrial associated membrane (MAMs) to the mitochondrial outer membrane. Associates with internal lipid rafts (LRs) in the MAM. .
♦ Isoform pUL37m: Host mitochondrion membrane
♦ Single-pass membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass membrane protein . Note=Not cleaved or N-glycosylated. .
Not Available
Not Available
NMR spectroscopy (1)
2LR1  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available