viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL26
Tegument protein UL26
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MYAVFGLTRSEVTPHEAAAARYKHRGVIDRQGAAMTSRRAPDGGLNLDDFMRRQRGRHLDLPYPRGYTLFVCDVEETILTPRDVEYWKLLVVTQGQLRVI
GTIGLANLFSWDRSVAGVAADGSVLCYEISRENFVVRAADSLPQLLERGLLHSYFEDVERAAQGRLRHGNRSGLRRDADGQVIRESACYVSRVLLRHRVT
PGKQEITDAMFEAGNVPSALLP
222
VAR_SEQ 1 34 Missing (in isoform 21kDa)
Not Available
20-01-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host NF-kappa-B. This inhibition affects both the canonical and the non-canonical pathways. Blocks the induction of host IKK phosphorylation. May also influence the normal phosphorylation state of several tegument proteins including pp28 in virions.
Not Available
Virion tegument . Host nucleus HGG3. Note=Also found in dense bodies. HGG3.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available