viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL7
CEACAM1-like protein UL7
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MASDVSSHLLTVTQSRWTIHHMYNKLLILALFTPVILESIIYVSGPQGGNVTLVSNFTSNISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQ
ITIFNLTLNDSGRYGAEGFTRSGENETFLWYNLTVKPKPLETTTASNVTTIVTTTPTVIGTKSNVTGNASLAPQLRAVAGFLNQTPRENNTHLALVGVIV
FIALIVVCIMGWWKLLCSKPKL
222
Not Available
Not Available
01-08-1990
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in modulating the host immune response and affecting host cytokine production. Structurally and functionally homolog of host CEACAM1, induces endothelial cell angiogenesis.
Not Available
GO:0005576  ;   GO:0016021  ;   GO:0020002  ;   GO:0039673  
♦ Secreted SWC3. Host cell membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available