viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GM UL100
Envelope glycoprotein M (gM)
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPCVYYHVVDFERLNMSAYNVMHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWI
KISMRKDKGMSLNQSTRDISYMGDSLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVHFFCLTIFNVSMVTQYRSYKRSLFFFSRLHPKLKGTVQFRT
LIVNLVEVALGFNTTVVAMALCYGFGNNFFVRTGHMVLAVFVVYAIISIIYFLLIEAVFFQYVKVQFGYHLGAFFGLCGLIYPIVQYDTFLSNEYRTGIS
WSFGMLFFIWAMFTTCRAVRYFRGRGSGSVKYQALATASGEEVAVLSHHDSLESRRLREEEDDDDDEDFEDA
372
Not Available
Not Available
01-08-1990
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope glycoprotein important for virion assembly and egress. Plays a role in the correct incorporation of gH-gL into virion membrane. Directs the glycoprotein N (gN) to the host trans-Golgi network.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0044175  ;   GO:0044177  ;   GO:0044201  ;  
GO:0055036  
♦ Virion membrane ,
♦ Multi-pass membrane protein , . Host Golgi apparatus, host trans-Golgi network , . Host endosome membrane
♦ Multi-pass membrane protein , . Host nucleus inner membrane
♦ Multi-pass membrane protein , . Note=During virion morphogenesis, this protein accumulates in the trans-Golgi network where secondary envelopment occurs. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available