Reviewed
Aedes Aegypti (Yellowfever Mosquito) (Culex Aegypti) [TaxID: 7159]; Homo Sapiens (Human) [TaxID: 9606]
N[Gene ID: 2648217 ]
Nucleoprotein (Nucleocapsid protein) (Protein N)
Bunyamwera Virus (BUNV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Peribunyaviridae> Orthobunyavirus> Bunyamwera Orthobunyavirus> Bunyamwera Virus (BUNV)
Various pathway(s) in which protein is involved
Not Available
MIELEFHDVAANTSSTFDPEVAYANFKRVHTTGLSYDHIRIFYIKGREIKTSLAKRSEWEVTLNLGGWKITVYNTNFPGNRNNPVPDDGLTLHRLSGFLA
RYLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTE
VQSALTVVSSLGWKKTNVSAAARDFLAKFGINM
RYLLEKMLKVSEPEKLIIKSKIINPLAEKNGITWNDGEEVYLSFFPGSEMFLGTFRFYPLAIGIYKVQRKEMEPKYLEKTMRQRYMGLEAATWTVSKLTE
VQSALTVVSSLGWKKTNVSAAARDFLAKFGINM
233
Not Available
Not Available
01-08-1990
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation.
Not Available
Virion. Note=Internal protein of virus particle.
Not Available
Not Available
X-ray crystallography (2)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available