viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Phlebotominae (sandflies) [TaxID: 7198]
P
Phosphoprotein (Protein P) (Protein M1)
Chandipura Virus (strain I653514) (CHPV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Chandipura Vesiculovirus> Chandipura Virus> Chandipura Virus (strain I653514) (CHPV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MEDSQLYQALKNYPKLQDTLDSIENLEDDTKSEPSECGSPTERGIPSYYLAEELDECEEEDSEEDDDNLPTEIPDPPTVDMLEAIMEDEIDDTAYQVHFE
AKQTWKPVIETGGNERGKFTLSVPQNLSALQLLQWETGIHALAERLGGCRLLQISTRGTRDGIEFTVRETPCVSPASDPIPSTSRSSSIASNVSTRQTES
PGSKSNTSLGIPEAPANLIDMGAIDKEFILAAISPSDPPYKNTLRNLFGSGDSFEQYNQTGIYSLKELVIAGLKRKGIYNRIRIRCHLEPQFN
293
Not Available
Not Available
01-08-1990
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. May act as a chaperone for newly synthesized free N protein, so-called N(0). Plays a role in virion assembly (By similarity).
Not Available
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available