Reviewed
Aedes Aegypti (Yellowfever Mosquito) (Culex Aegypti) [TaxID: 7159]; Aedes Albopictus (Asian Tiger Mosquito) (Stegomyia Albopicta) [TaxID: 7160]; Aedes Furcifer (Mosquito) [TaxID: 299627]; Aedes Taylori (Mosquito) [TaxID: 299628]; Erythrocebus Patas (Red Guenon) (Cercopithecus Patas) [TaxID: 9538]; Homo Sapiens (Human) [TaxID: 9606]
Not Available
Genome polyprotein [Cleaved into: Envelope protein E] (Fragment)
Dengue Virus Type 2 (isolate Malaysia M3) (DENV-2)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Flaviviridae> Flavivirus (arboviruses Group B)> Dengue Virus Group> Dengue Virus> Dengue Virus 2> Dengue Virus Type 2 (isolate Malaysia M3) (DENV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFEVIKTEAKQPATLRKSCFEAKLTNTTTESRCPTLGEPSLNEEQDKRLVCKHSMVDRG
WGNGCGLFGKGGIVTCAMFTCKKNMEGKFVHPENLEYTIVITPHSGEEHAVGNDTGKHGKELKITPQSSITEAELTGYGTVTMQCSPRTGLDFNEIVLLQ
MEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMQTALTGAAEIQMSSGNLLFTGHLKCRLRMDKLQLKGISYS
MCTGKFKIVKEFAETQHGTIVIRVQYEGDGSPCKIPFEIIDLEKRHVLGCLITVYPIVTEKDSPVNIEADPPFGDSYIIIGIEPGQLKLHWLKKGSSIGQ
MFETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALNQVFGTIYGAAFSGVSWTMKILIGVIITCIGMNSRSTSLSVSLVLVGVVTLYLGGMVHA
WGNGCGLFGKGGIVTCAMFTCKKNMEGKFVHPENLEYTIVITPHSGEEHAVGNDTGKHGKELKITPQSSITEAELTGYGTVTMQCSPRTGLDFNEIVLLQ
MEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMQTALTGAAEIQMSSGNLLFTGHLKCRLRMDKLQLKGISYS
MCTGKFKIVKEFAETQHGTIVIRVQYEGDGSPCKIPFEIIDLEKRHVLGCLITVYPIVTEKDSPVNIEADPPFGDSYIIIGIEPGQLKLHWLKKGSSIGQ
MFETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALNQVFGTIYGAAFSGVSWTMKILIGVIITCIGMNSRSTSLSVSLVLVGVVTLYLGGMVHA
495
Not Available
Not Available
01-01-1990
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Envelope protein E: Binds to host cell surface receptor and mediates fusion between viral and cellular membranes. Envelope protein is synthesized in the endoplasmic reticulum in the form of heterodimer with protein prM. They play a role in virion budding in the ER, and the newly formed immature particle is covered with 60 spikes composed of heterodimer between precursor prM and envelope protein E. The virion is transported to the Golgi apparatus where the low pH causes dissociation of PrM-E heterodimers and formation of E homodimers. prM-E cleavage is inefficient, and many virions are only partially matured. These uncleaved prM would play a role in immune evasion.
Not Available
GO:0016021 ; GO:0019013 ; GO:0019031 ; GO:0019062 ; GO:0039654 ;
GO:0044167 ; GO:0046983 ; GO:0055036 ; GO:0075512
GO:0044167 ; GO:0046983 ; GO:0055036 ; GO:0075512
♦ Envelope protein E: Virion membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein .
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available