viHumans
Reviewed
Aedimorphus [TaxID: 53540]; Diceromyia [TaxID: 53539]; Erythrocebus Patas (Red Guenon) (Cercopithecus Patas) [TaxID: 9538]; Homo Sapiens (Human) [TaxID: 9606]; Stegomyia [TaxID: 53541]
Not Available
Genome polyprotein [Cleaved into: Envelope protein E] (Fragment)
Dengue Virus Type 2 (isolate Malaysia M2) (DENV-2)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Flaviviridae> Flavivirus (arboviruses Group B)> Dengue Virus Group> Dengue Virus> Dengue Virus 2> Dengue Virus Type 2 (isolate Malaysia M2) (DENV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFVCKHSMVDRG
WGNGCGLFGKGGIVTCAMFTCQKNMEGKIVQPENLEYTIVVTPHSGEEHAVGNDTGKHGKEIKITPQSSITEAELTGYGTVTMDCSPRTGLDFNEMVLLQ
MENKAWLVHRQWFLDLPLPWLPGADTQGSKLDQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYS
MCTGKFKVVEEIAETQHGTIVIRVQYEGDGSPCKIPLEIMDLDNRHVLGRLITVNPIVTEKDSPVNVEAEPPLGDSYIIIGVEPGQLKLNWFKKGSSIGQ
MFETTMIRAKRMAILGDTAWDFRSLGGVFTSIGKALHQVFGAIYGAAFSGVSWTMKILIGVIITWIGMNSRSTSLSVSLVLVGIVTLYLGVMVQA
495
Not Available
Not Available
01-01-1990
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope protein E: Binds to host cell surface receptor and mediates fusion between viral and cellular membranes. Envelope protein is synthesized in the endoplasmic reticulum in the form of heterodimer with protein prM. They play a role in virion budding in the ER, and the newly formed immature particle is covered with 60 spikes composed of heterodimer between precursor prM and envelope protein E. The virion is transported to the Golgi apparatus where the low pH causes dissociation of PrM-E heterodimers and formation of E homodimers. prM-E cleavage is inefficient, and many virions are only partially matured. These uncleaved prM would play a role in immune evasion.
Not Available
GO:0016021  ;   GO:0019013  ;   GO:0019031  ;   GO:0019062  ;   GO:0039654  ;  
GO:0044167  ;   GO:0046983  ;   GO:0055036  ;   GO:0075512  
♦ Envelope protein E: Virion membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane , PROSITE-ProRule:PRU00860
♦ Multi-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available