viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L2
Pre-core protein X (pX) (11 kDa core protein) (Protein mu) (pMu) [Cleaved into: Core protein X]
Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus C> Human Adenovirus C Serotype 2 (HAdV-2) (Human Adenovirus 2)
AC_000007.1 ;   
Various pathway(s) in which protein is involved
Not Available
Not Available
MALTCRLRFPVPGFRGRMHRRRGMAGHGLTGGMRRAHHRRRRASHRRMRGGILPLLIPLIAAAIGAVPGIASVALQAQRH
80
Not Available
Not Available
23-01-2007
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Pre-core protein X: Interacts with the viral DNA and aids in tightly condensing it within the capsid. Cleavage of pre-core protein X may serve to partially relax this structure within the mature virion prior to its entry into the nucleus.
Not Available
♦ Pre-core protein X: Host nucleus, host nucleolus. Note=Excluded from adenovirus DNA-binding protein (DBP)-rich replication centers in adenovirus-infected cells.
♦ Core protein X: Virion. Note=Located inside the capsid in association with the viral DNA (core). Present in about 126-160 copies per virion. Excluded from adenovirus DNA-binding protein (DBP)-rich replication centers in adenovirus-infected cells.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available