viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mesocricetus Auratus (Golden Hamster) [TaxID: 10036]; Mus Musculus (Mouse) [TaxID: 10090]
L
RNA-directed RNA polymerase L (Protein L) (EC 2.7.7.48) (Large structural protein) (Replicase) (Transcriptase) (Fragment)
Lymphocytic Choriomeningitis Virus (strain WE) (LCMV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Lymphocytic Choriomeningitis Mammarenavirus> Lymphocytic Choriomeningitis Virus (strain WE) (LCMV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDETIADLRELCLNYIEQDERLSRQKLNFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCIHNHDDKSVETILIDSGIVCPGLPLIIPDGYKLIDNSLIL
LECFVRSTPASFEKKFIEDTNKLACIKEDLAVAGITLVPIVDGRCDYDNSFMPEWVNFKFRDLLFKLLEYSSQDEKVFEESEYFRLCESLKTTVDKRSGM
DSMKILKDARSFHNDEIMKMCHDGVNPNMSCDDVVFGINSFFGRFRRDLLNGKLKRNFQKVSPGGLIKEFSELYETLTDNDDILMLSKEPVESCPLMRFI
TAETHGHERGSDANTEYERLLSMLNKVKSLKLLNTRRRQLLNLDVLCPSSLIKQSISKGLEND
363
Not Available
Not Available
01-01-1990
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
RNA-dependent RNA polymerase which is responsible for replication and transcription of the viral RNA genome. During transcription, synthesizes 4 subgenomic RNAs, and assures their capping by a cap-snatching mechanism, in which cellular capped pre-mRNA are used to generate primers for viral transcription. The 3'-end of subgenomic mRNAs molecules are heterogeneous and not polyadenylated. The replicase function is to direct synthesis of antigenomic and genomic RNA which are encapsidated and non capped. As a consequence of the use of the same enzyme for both transcription and replication, these mechanisms need to be well coordinated. These processes may be regulated by proteins N and Z in a dose-dependent manner (By similarity).
2.7.7.48  
GO:0000166  ;   GO:0003968  ;   GO:0019012  ;   GO:0019079  ;   GO:0030430  
Virion. Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available